Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsd17b12 Peptide - C-terminal region

Hsd17b12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610510O05Rik, AI172963, KIK-I, Kik1

UniProt

O70503

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsd17b12 Rabbit Polyclonal Antibody (orb579989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062631

Preservative

Lyophilized powder

AA Sequence

SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH13 Human siRNA Oligo Duplex (Locus ID 8735)
SR305753 1 Kit

MYH13 Human siRNA Oligo Duplex (Locus ID 8735)

Sign In for Pricing
View Details
Period Circadian Protein 2 (Phospho-Ser662) Polyclonal Conjugated Antibody
C12112 100 µL

Period Circadian Protein 2 (Phospho-Ser662) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Anti-Giardia lamblia Ceramide glucosyltransferase Antibody Fluoro647 Conjugated
DZ41099-Fluoro647 200 µL/Vial

Anti-Giardia lamblia Ceramide glucosyltransferase Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)
MBS2056818-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)
MBS2056818-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)
MBS2056818-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Linked Kinase (ILK)

Sign In for Pricing
View Details