Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst11 Peptide - N-terminal region

Chst11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110020P09Rik, C4ST, C4ST-1, C4ST1, C4s

UniProt

Q9JME2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst11 Rabbit Polyclonal Antibody (orb580057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067414

Preservative

Lyophilized powder

AA Sequence

RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Tryptophan 5 hydroxylase 1 (TPH1) ELISA kit
GTR10434582 96 Well

Sheep Tryptophan 5 hydroxylase 1 (TPH1) ELISA kit

Sign In for Pricing
View Details
Rabbit anti-CMTM4 Antibody
MBS4509699-01 0.05 mL

Rabbit anti-CMTM4 Antibody

Sign In for Pricing
View Details
Rabbit anti-CMTM4 Antibody
MBS4509699-02 0.1 mL

Rabbit anti-CMTM4 Antibody

Sign In for Pricing
View Details
Rabbit anti-CMTM4 Antibody
MBS4509699-03 5x 0.1 mL

Rabbit anti-CMTM4 Antibody

Sign In for Pricing
View Details
Mouse Granzyme B (GZMB) ELISA Kit
EKL62032 96 Tests

Mouse Granzyme B (GZMB) ELISA Kit

Sign In for Pricing
View Details
GRP78/Bip (10C9) Mouse mAb
E2250211 100 µL

GRP78/Bip (10C9) Mouse mAb

Sign In for Pricing
View Details