Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Chst11 Peptide - N-terminal region

Chst11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110020P09Rik, C4ST, C4ST-1, C4ST1, C4s

UniProt

Q9JME2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Chst11 Rabbit Polyclonal Antibody (orb580057) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067414

Preservative

Lyophilized powder

AA Sequence

RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFASC sgRNA CRISPR Lentivector set (Human)
K1420901 3x 1.0 µg

NFASC sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal PP2C gamma/PPM1G Antibody (001) [Janelia Fluor 646]
NBP2-89857JF646 0.1 mL

Rabbit Monoclonal PP2C gamma/PPM1G Antibody (001) [Janelia Fluor 646]

Sign In for Pricing
View Details
CBR3 Antibody (YA2395, Rabbit)
HY-P82650-01 10 µL

CBR3 Antibody (YA2395, Rabbit)

Sign In for Pricing
View Details
CBR3 Antibody (YA2395, Rabbit)
HY-P82650-02 50 μL

CBR3 Antibody (YA2395, Rabbit)

Sign In for Pricing
View Details
CBR3 Antibody (YA2395, Rabbit)
HY-P82650-03 100 µL

CBR3 Antibody (YA2395, Rabbit)

Sign In for Pricing
View Details
Plant Total RNA Isolation Reagent
orb180506 100 Reactions

Plant Total RNA Isolation Reagent

Sign In for Pricing
View Details