Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan6 Peptide - C-terminal region

Zkscan6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700128E15Rik, D11Ertd714e, KOX11, Zfp535, Znf18

UniProt

Q810A1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zkscan6 Rabbit Polyclonal Antibody (orb325361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080383

Preservative

Lyophilized powder

AA Sequence

FSGLRHHEKIHTGEKPYKCPLCEKSFIQRSNFNRHQRVHTGEKPYKCTHC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1R-Hydroxy-5-keto Tiamulin
TRC-H942765-2.5MG 2.5 mg

1R-Hydroxy-5-keto Tiamulin

Sign In for Pricing
View Details
Weigh Boats
B6001B 500 Sheets/Pack

Weigh Boats

Sign In for Pricing
View Details
Mucolipin 1 (MCOLN1) (NM_020533) Human Over-expression Lysate
LC402793 20 µg

Mucolipin 1 (MCOLN1) (NM_020533) Human Over-expression Lysate

Sign In for Pricing
View Details
TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)
KN202741RB 1 Kit

TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCFD1 (C-term) Rabbit Polyclonal Antibody
AP17731PU-N 400 µL

SCFD1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (rPAX8/1492), CF405S conjugate, 0.1mg/mL
BNC043196-100 1x 100 µL

PAX8 (Renal Cell Marker) (rPAX8/1492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details