E2f7 Peptide - middle region
E2f7 Peptide - middle region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with E2f7 Rabbit Polyclonal Antibody (orb330518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001101562
Preservative
Lyophilized powder
AA Sequence
NSLQLDVVGDSAVDDYEKRRPSRKQKSLGLLCQKFLARYPSYPLSTEKTT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
32229111 3x 1.0 µg
NT5DC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
X1034-10G 100 µg
XIAP (X-linked Inhibitor of Apoptosis Protein, X-linked IAP, API3, Baculoviral IAP Repeat-containing Protein 4, BIRC4, E3 Ubiquitin-protein Ligase XIAP, FLJ26913, IAP-like Protein, ILP, hILP, ILP1, Inhibitor of Apoptosis Protein 3, IAP3, IAP-3, hIAP3, hIAP-3, MIHA, XLP2) discontinued
Sign In for Pricing
View Details K9019-FITC 100 µL
Kv4.3 (Kcnd3, Voltage-gated Potassium Channel) (FITC) discontinued
Sign In for Pricing
View Details