Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f7 Peptide - middle region

E2f7 Peptide - middle region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with E2f7 Rabbit Polyclonal Antibody (orb330518) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101562

Preservative

Lyophilized powder

AA Sequence

NSLQLDVVGDSAVDDYEKRRPSRKQKSLGLLCQKFLARYPSYPLSTEKTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuroglobin (NGB) Bovine ELISA Kit
F3347 96 Tests

Neuroglobin (NGB) Bovine ELISA Kit

Sign In for Pricing
View Details
F/F009/NT-ALU-200X200/1-B Fire & Disaster Signs (No Adhesive)
135888 1 Pack (1 Panel (s) x 1 Pack)

F/F009/NT-ALU-200X200/1-B Fire & Disaster Signs (No Adhesive)

Sign In for Pricing
View Details
USH2A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV669016 1.0 µg DNA

USH2A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Serpina1d Protein, Mouse, Recombinant
E45M53373M0-50 50 µg

Serpina1d Protein, Mouse, Recombinant

Sign In for Pricing
View Details
Anti-Human CD18/ITGB2 & CD11/ITGAL Antibody (23F2G), PE
MBS1582680-01 50 Tests

Anti-Human CD18/ITGB2 & CD11/ITGAL Antibody (23F2G), PE

Sign In for Pricing
View Details
Anti-Human CD18/ITGB2 & CD11/ITGAL Antibody (23F2G), PE
MBS1582680-02 100 Tests

Anti-Human CD18/ITGB2 & CD11/ITGAL Antibody (23F2G), PE

Sign In for Pricing
View Details