SELENOF Peptide - C-terminal region
SELENOF Peptide - C-terminal region
Product Specifications
Product Name Alternative
45184
UniProt
Q923V8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SELENOF Rabbit Polyclonal Antibody (orb55684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_579831
Preservative
Lyophilized powder
AA Sequence
LFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details