Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mdh1 Peptide - N-terminal region

Mdh1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B230377B03Rik, D17921, MDH-s, MDHA, Mor-2, Mor2

UniProt

P14152

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mdh1 Rabbit Polyclonal Antibody (orb580359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032644

Preservative

Lyophilized powder

AA Sequence

YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rars2 3'UTR Lenti-reporter-Luc Vector
38521084 1.0 µg

Rars2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BUB1 Blocking Peptide
CBP6270-01 1 mg

BUB1 Blocking Peptide

Sign In for Pricing
View Details
BUB1 Blocking Peptide
CBP6270-02 5 mg

BUB1 Blocking Peptide

Sign In for Pricing
View Details
6-Oxo DL-Norleucine, Formate Salt
TRC-O870140-2.5MG 2.5 mg

6-Oxo DL-Norleucine, Formate Salt

Sign In for Pricing
View Details
Svs6 sgRNA CRISPR Lentivector set (Mouse)
K3255901 3x 1.0 µg

Svs6 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TYW3 293 Cell Lysate
404696 0.1 mg

TYW3 293 Cell Lysate

Sign In for Pricing
View Details