Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mdh1 Peptide - N-terminal region

Mdh1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

B230377B03Rik, D17921, MDH-s, MDHA, Mor-2, Mor2

UniProt

P14152

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mdh1 Rabbit Polyclonal Antibody (orb580359) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032644

Preservative

Lyophilized powder

AA Sequence

YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Death Associated Protein Kinase 1 (DAPK1)
SIPC773Mu01-01 10 µg

Recombinant Death Associated Protein Kinase 1 (DAPK1)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 1 (DAPK1)
SIPC773Mu01-02 50 µg

Recombinant Death Associated Protein Kinase 1 (DAPK1)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 1 (DAPK1)
SIPC773Mu01-03 200 µg

Recombinant Death Associated Protein Kinase 1 (DAPK1)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 1 (DAPK1)
SIPC773Mu01-04 1 mg

Recombinant Death Associated Protein Kinase 1 (DAPK1)

Sign In for Pricing
View Details
Recombinant Death Associated Protein Kinase 1 (DAPK1)
SIPC773Mu01-05 5 mg

Recombinant Death Associated Protein Kinase 1 (DAPK1)

Sign In for Pricing
View Details
PARP1 Recombinant Rabbit mAb
E43S47406 100 µL

PARP1 Recombinant Rabbit mAb

Sign In for Pricing
View Details