Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gdap1l1 Peptide - C-terminal region

Gdap1l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gdap1l

UniProt

B4F774

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gdap1l1 Rabbit Polyclonal Antibody (orb580868) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101268

Preservative

Lyophilized powder

AA Sequence

FLGLSKKYWEDGSRPNLQSFFERVQRRLAFRKVLGDIHTTLLSAVIPNAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorthalidone impurity
T82735-01 5 mg

Chlorthalidone impurity

Sign In for Pricing
View Details
Chlorthalidone impurity
T82735-02 50 mg

Chlorthalidone impurity

Sign In for Pricing
View Details
Recombinant Chlamydia muridarum DNA translocase FtsK (ftsK), partial
MBS7099957 Inquire

Recombinant Chlamydia muridarum DNA translocase FtsK (ftsK), partial

Sign In for Pricing
View Details
SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII)
MBS6000975-01 0.2 mL

SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII)

Sign In for Pricing
View Details
SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII)
MBS6000975-02 5x 0.2 mL

SYT13, NT (SYT13, KIAA1427, Synaptotagmin-13, Synaptotagmin XIII)

Sign In for Pricing
View Details
SULT1A1 Polyclonal Antibody, RBITC Conjugated
bs-6283R-RBITC 100 µL

SULT1A1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details