Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh20 Peptide - middle region

Cdh20 Peptide - middle region

Product Specifications

Product Name Alternative

Cad20

UniProt

Q5DWV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdh20 Rabbit Polyclonal Antibody (orb580951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012766

Preservative

Lyophilized powder

AA Sequence

DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor-Interacting Protein 3 (RIP3) Antibody (ATTO 655)
abx446914 100 µg

Receptor-Interacting Protein 3 (RIP3) Antibody (ATTO 655)

Sign In for Pricing
View Details
Histidine-proline-richGlycoprotein (HPRG) Human ELISA Kit
95527 96 Tests

Histidine-proline-richGlycoprotein (HPRG) Human ELISA Kit

Sign In for Pricing
View Details
TRIP (TRAIP) (NM_005879) Human Over-expression Lysate
LC416999 20 µg

TRIP (TRAIP) (NM_005879) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM13C CRISPRa sgRNA lentivector (set of three targets)(Human)
19784121 3x 1.0µg DNA

FAM13C CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
FLJ39582 Human qPCR Primer Pair (NM_178315)
HP218786 200 Reactions

FLJ39582 Human qPCR Primer Pair (NM_178315)

Sign In for Pricing
View Details
Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit
YLA0469HU-01 48 Tests

Human Thymidine Kinase 1, Soluble (TK1) ELISA Kit

Sign In for Pricing
View Details