Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdh20 Peptide - middle region

Cdh20 Peptide - middle region

Product Specifications

Product Name Alternative

Cad20

UniProt

Q5DWV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdh20 Rabbit Polyclonal Antibody (orb580951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012766

Preservative

Lyophilized powder

AA Sequence

DVTIGTTIQIISAKDPDMTNNSIRYSIDRGSDPGRFFYVDITTGALMTAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UG-01 25 µg

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD31 Antibody[390]
E-AB-F1180UG-02 100 µg

PE/Cyanine5 Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
Olr886 Rat siRNA Oligo Duplex (Locus ID 302254)
SR512206 1 Kit

Olr886 Rat siRNA Oligo Duplex (Locus ID 302254)

Sign In for Pricing
View Details
CRB2 (NM_173689) Human Tagged ORF Clone
RG216815 10 µg

CRB2 (NM_173689) Human Tagged ORF Clone

Sign In for Pricing
View Details
39S ribosomal protein L40 mitochondrial (MRPL40) Human ELISA Kit
B0738 96 Tests

39S ribosomal protein L40 mitochondrial (MRPL40) Human ELISA Kit

Sign In for Pricing
View Details
TFAP4 siRNA Oligos set (Human)
46561171 3x 5 nmol

TFAP4 siRNA Oligos set (Human)

Sign In for Pricing
View Details