Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ik Peptide - C-terminal region

Ik Peptide - C-terminal region

Product Specifications

Product Name Alternative

MuRED

UniProt

Q9Z1M8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ik Rabbit Polyclonal Antibody (orb581337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036009

Preservative

Lyophilized powder

AA Sequence

GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Dopachrome Tautomerase (DDT) Antibody
abx129771-01 100 µL

D-Dopachrome Tautomerase (DDT) Antibody

Sign In for Pricing
View Details
D-Dopachrome Tautomerase (DDT) Antibody
abx129771-02 200 µL

D-Dopachrome Tautomerase (DDT) Antibody

Sign In for Pricing
View Details
D-Dopachrome Tautomerase (DDT) Antibody
abx129771-03 1 mL

D-Dopachrome Tautomerase (DDT) Antibody

Sign In for Pricing
View Details
Lipocalin 2 (LCN2, Neutrophil Gelatinase-associated Lipocalin, NGAL) (HRP) discontinued
214977-HRP 100 µL

Lipocalin 2 (LCN2, Neutrophil Gelatinase-associated Lipocalin, NGAL) (HRP) discontinued

Sign In for Pricing
View Details
FZD8 Antibody
A51526-100UL 100 µL

FZD8 Antibody

Sign In for Pricing
View Details
RAB28 CRISPR Knock Out 293T Cell Line (Human)
38317141 1x 10^6 Cells / 1.0 mL

RAB28 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details