Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ik Peptide - C-terminal region

Ik Peptide - C-terminal region

Product Specifications

Product Name Alternative

MuRED

UniProt

Q9Z1M8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ik Rabbit Polyclonal Antibody (orb581337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036009

Preservative

Lyophilized powder

AA Sequence

GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbi! anti-CIAPINl Antibody, Affinity Purified
A302-809A-T 2 µg

Rabbi! anti-CIAPINl Antibody, Affinity Purified

Sign In for Pricing
View Details
CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4) (MaxLight 650) discontinued
034258-ML650 100 µL

CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lhfpl3 3'UTR GFP Stable Cell Line
TU161037 1.0 mL

Lhfpl3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Spectinomycin sulfate
TN10920-01 10 mg

Spectinomycin sulfate

Sign In for Pricing
View Details
Spectinomycin sulfate
TN10920-02 50 mg

Spectinomycin sulfate

Sign In for Pricing
View Details
DRAK1 Antibody (N-term)
MBS9209722-01 0.08 mL

DRAK1 Antibody (N-term)

Sign In for Pricing
View Details