Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufa10l1 Peptide - C-terminal region

Ndufa10l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ndufa10

UniProt

Q561S0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufa10l1 Rabbit Polyclonal Antibody (orb325670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872612

Preservative

Lyophilized powder

AA Sequence

KREVLNYTTVPVYLPEITIGAHQGSRIYDSFRELPGRKYAPGYNADVGDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r125 Mouse Gene Knockout Kit (CRISPR)
KN518927 1 Kit

Vmn1r125 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MDA5 Recombinant Rabbit Monoclonal Antibody [PSH03-56]
HA722015 100 µL

MDA5 Recombinant Rabbit Monoclonal Antibody [PSH03-56]

Sign In for Pricing
View Details
TSGA14 (CEP41) (NM_018718) Human Recombinant Protein
TP311962L 1 mg

TSGA14 (CEP41) (NM_018718) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS704359 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Phenylmercuric Acetate
TRC-P335635-5G 5 g

Phenylmercuric Acetate

Sign In for Pricing
View Details
TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2C1]
CF805459 100 µg

TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2C1]

Sign In for Pricing
View Details