Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufa10l1 Peptide - C-terminal region

Ndufa10l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ndufa10

UniProt

Q561S0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufa10l1 Rabbit Polyclonal Antibody (orb325670) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872612

Preservative

Lyophilized powder

AA Sequence

KREVLNYTTVPVYLPEITIGAHQGSRIYDSFRELPGRKYAPGYNADVGDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMD1 Human Gene Knockout Kit (CRISPR)
KN422723 1 Kit

LIMD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-O-Ethyl-L-ascorbic Acid
TRC-E922013-10MG 10 mg

3-O-Ethyl-L-ascorbic Acid

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF640R conjugate, 0.1mg/mL
BNC402550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem114 Mouse Gene Knockout Kit (CRISPR)
KN503417 1 Kit

Tmem114 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKAIN2 (NM_001040214) Human Over-expression Lysate
LY421727 100 µg

NKAIN2 (NM_001040214) Human Over-expression Lysate

Sign In for Pricing
View Details
[13C5]Xylitol
TRC-X749751-100MG 100 mg

[13C5]Xylitol

Sign In for Pricing
View Details