Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cela3b Peptide - middle region

Cela3b Peptide - middle region

Product Specifications

Product Name Alternative

Ela3b

UniProt

D3ZFG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cela3b Rabbit Polyclonal Antibody (orb582494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100162

Preservative

Lyophilized powder

AA Sequence

PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM41 Polyclonal Antibody
MBS9238734-01 0.1 mL

TRIM41 Polyclonal Antibody

Sign In for Pricing
View Details
TRIM41 Polyclonal Antibody
MBS9238734-02 5x 0.1 mL

TRIM41 Polyclonal Antibody

Sign In for Pricing
View Details
REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 750)
MBS6341222-01 0.1 mL

REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 750)

Sign In for Pricing
View Details
REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 750)
MBS6341222-02 5x 0.1 mL

REEP5, CT (REEP5, C5orf18, DP1, TB2, Receptor expression-enhancing protein 5, Polyposis locus protein 1, Protein TB2) (MaxLight 750)

Sign In for Pricing
View Details
NDUFS5 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 5, Complex I-15kD, CI-15kD, NADH-ubiquinone Oxidoreductase 15kD Subunit) (PE)
130241-PE 100 µL

NDUFS5 (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 5, Complex I-15kD, CI-15kD, NADH-ubiquinone Oxidoreductase 15kD Subunit) (PE)

Sign In for Pricing
View Details
Bid (BH3-interacting Domain Death Agonist, p22 BID) discontinued
B1095-03G 100 µg

Bid (BH3-interacting Domain Death Agonist, p22 BID) discontinued

Sign In for Pricing
View Details