Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cela3b Peptide - middle region

Cela3b Peptide - middle region

Product Specifications

Product Name Alternative

Ela3b

UniProt

D3ZFG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cela3b Rabbit Polyclonal Antibody (orb582494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100162

Preservative

Lyophilized powder

AA Sequence

PNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 1-oxo-1H,2H-pyrrolo[1,2-a]pyrazine-3-carboxylate
UEA75620-01 50 mg

Methyl 1-oxo-1H,2H-pyrrolo[1,2-a]pyrazine-3-carboxylate

Sign In for Pricing
View Details
Methyl 1-oxo-1H,2H-pyrrolo[1,2-a]pyrazine-3-carboxylate
UEA75620-02 0.5 g

Methyl 1-oxo-1H,2H-pyrrolo[1,2-a]pyrazine-3-carboxylate

Sign In for Pricing
View Details
Active Interleukin 25 (IL25)
MBS2153497-01 0.01 mg

Active Interleukin 25 (IL25)

Sign In for Pricing
View Details
Active Interleukin 25 (IL25)
MBS2153497-02 0.05 mg

Active Interleukin 25 (IL25)

Sign In for Pricing
View Details
Active Interleukin 25 (IL25)
MBS2153497-03 0.1 mg

Active Interleukin 25 (IL25)

Sign In for Pricing
View Details
Active Interleukin 25 (IL25)
MBS2153497-04 0.2 mg

Active Interleukin 25 (IL25)

Sign In for Pricing
View Details