Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pou3f3 Peptide - C-terminal region

Pou3f3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Brn1, RHS1

UniProt

Q63262

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pou3f3 Rabbit Polyclonal Antibody (orb583760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620192

Preservative

Lyophilized powder

AA Sequence

VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex PCR Mix
PC1260-01 50 Reactions

Multiplex PCR Mix

Sign In for Pricing
View Details
Multiplex PCR Mix
PC1260-02 100 Reactions

Multiplex PCR Mix

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)
MBS1199729-01 0.02 mg (E-Coli)

Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)
MBS1199729-02 0.1 mg (E-Coli)

Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)
MBS1199729-03 0.02 mg (Yeast)

Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)
MBS1199729-04 0.1 mg (Yeast)

Recombinant Aspergillus clavatus Histone H2A.Z-specific chaperone chz1 (chz1)

Sign In for Pricing
View Details