Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arih2 Peptide - C-terminal region

Arih2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARI2, TRIAD1

UniProt

D3ZJB8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arih2 Rabbit Polyclonal Antibody (orb583782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012275

Preservative

Lyophilized powder

AA Sequence

YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Guanosine Monophosphate Reductase (GMPR) Protein
abx073325-01 5 µg

Human Guanosine Monophosphate Reductase (GMPR) Protein

Sign In for Pricing
View Details
Human Guanosine Monophosphate Reductase (GMPR) Protein
abx073325-02 20 µg

Human Guanosine Monophosphate Reductase (GMPR) Protein

Sign In for Pricing
View Details
Human Guanosine Monophosphate Reductase (GMPR) Protein
abx073325-03 1 mg

Human Guanosine Monophosphate Reductase (GMPR) Protein

Sign In for Pricing
View Details
MCC (NM_002387) Human Tagged ORF Clone
RG202890 10 µg

MCC (NM_002387) Human Tagged ORF Clone

Sign In for Pricing
View Details
TAF9BP2 3'UTR GFP Stable Cell Line
TU075095 1.0 mL

TAF9BP2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NDOR1 (NM_014434) Human Over-expression Lysate
LY415283 100 µg

NDOR1 (NM_014434) Human Over-expression Lysate

Sign In for Pricing
View Details