Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Impa2 Peptide - C-terminal region

Impa2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2210415D20Rik, AI326924, AW259601

UniProt

Q91UZ5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Impa2 Rabbit Polyclonal Antibody (orb330962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444491

Preservative

Lyophilized powder

AA Sequence

GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR12D3 Human Gene Knockout Kit (CRISPR)
KN418062 1 Kit

OR12D3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 18 Recombinant Rabbit Monoclonal Antibody [SZ80-07]
ET1603-8 100 µL

Cytokeratin 18 Recombinant Rabbit Monoclonal Antibody [SZ80-07]

Sign In for Pricing
View Details
Mouse Capg activation kit by CRISPRa
GA200511 1 Kit

Mouse Capg activation kit by CRISPRa

Sign In for Pricing
View Details
LPHN2 Antibody
8G378-AAT 50 µg

LPHN2 Antibody

Sign In for Pricing
View Details
PHLPP2 (N-term) Rabbit Polyclonal Antibody
AP14594PU-N 400 µL

PHLPP2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS629550 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details