Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Impa2 Peptide - C-terminal region

Impa2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2210415D20Rik, AI326924, AW259601

UniProt

Q91UZ5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Impa2 Rabbit Polyclonal Antibody (orb330962) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444491

Preservative

Lyophilized powder

AA Sequence

GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ESRP2 (NM_024939) Human Recombinant Protein
TP304916L 1 mg

ESRP2 (NM_024939) Human Recombinant Protein

Sign In for Pricing
View Details
Human CKS2 activation kit by CRISPRa
GA100835 1 Kit

Human CKS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) Rabbit Polyclonal Antibody
TA365782 100 µL

Deoxyribonuclease I like 1 (DNASE1L1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF405S conjugate, 0.1mg/mL
BNC041700-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Clusterin (CLU) Rabbit Polyclonal Antibody
TA371638 100 µL

Clusterin (CLU) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502904 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details