Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL36G Peptide - middle region

IL36G Peptide - middle region

Product Specifications

Product Name Alternative

IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2

UniProt

Q9NZH8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL36G Rabbit Polyclonal Antibody (orb586614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062564

Preservative

Lyophilized powder

AA Sequence

ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MYSM1 Protein, N-His
orb3153941-01 50 µg

Recombinant Human MYSM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MYSM1 Protein, N-His
orb3153941-02 100 µg

Recombinant Human MYSM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human MYSM1 Protein, N-His
orb3153941-03 1 mg

Recombinant Human MYSM1 Protein, N-His

Sign In for Pricing
View Details
Mouse T-Lymphocyte Activation Antigen CD86 / B7-2 (CD86) ELISA Kit
abx514118 96 Well

Mouse T-Lymphocyte Activation Antigen CD86 / B7-2 (CD86) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rhesus Macaque C1QC Protein, His (Fc)-Avi-tagged
C1QC-414R 50 µg

Recombinant Rhesus Macaque C1QC Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
ARQ 531 5mg
A19823-5 5 mg

ARQ 531 5mg

Sign In for Pricing
View Details