Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL36G Peptide - middle region

IL36G Peptide - middle region

Product Specifications

Product Name Alternative

IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2

UniProt

Q9NZH8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL36G Rabbit Polyclonal Antibody (orb586614) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062564

Preservative

Lyophilized powder

AA Sequence

ITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-04 1 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-05 5 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)
MBS2063212-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Growth Differentiation Factor 11 (GDF11)

Sign In for Pricing
View Details