Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPRE2 Peptide - C-terminal region

MAPRE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EB1, EB2, RP1

UniProt

Q15555

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPRE2 Rabbit Polyclonal Antibody (orb586626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055083

Preservative

Lyophilized powder

AA Sequence

LLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tubulin beta-2A chain Protein, His, Yeast-1mg
QP6852-ye-1mg 1mg

Recombinant Human Tubulin beta-2A chain Protein, His, Yeast-1mg

Sign In for Pricing
View Details
GPCR2037 shRNA (m) Lentiviral Particles
sc-60720-V 200 µL

GPCR2037 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]
TA804202 100 µL

N4BP2L2 Mouse Monoclonal Antibody [Clone ID: OTI7F5]

Sign In for Pricing
View Details
Fluorescent PMMA Particles, Yellow/Purple/Sky Blue, 0.2% w/v, 0.1-0.3 µm
FPMA-0261-2 2 mL

Fluorescent PMMA Particles, Yellow/Purple/Sky Blue, 0.2% w/v, 0.1-0.3 µm

Sign In for Pricing
View Details
Chicken Charged multivesicular body protein 2b (CHMP2B) ELISA Kit
MBS7218671-01 48 Well

Chicken Charged multivesicular body protein 2b (CHMP2B) ELISA Kit

Sign In for Pricing
View Details
Chicken Charged multivesicular body protein 2b (CHMP2B) ELISA Kit
MBS7218671-02 96 Well

Chicken Charged multivesicular body protein 2b (CHMP2B) ELISA Kit

Sign In for Pricing
View Details