Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPRE2 Peptide - C-terminal region

MAPRE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

EB1, EB2, RP1

UniProt

Q15555

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPRE2 Rabbit Polyclonal Antibody (orb586626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055083

Preservative

Lyophilized powder

AA Sequence

LLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Thrombomodulin (TM) ELISA Kit
EIA06433p 1 Kit

Porcine Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
S100P Antibody
orb2808622 100 µL

S100P Antibody

Sign In for Pricing
View Details
OR51F2 Protein Vector (Human) (pPB-N-His)
PV107415 500 ng

OR51F2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ASK6 Polyclonal Antibody
MBS7192135 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ASK6 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Katanin p60 ATPase-containing subunit A1 (Katna1)
MBS1352223-01 0.02 mg (E-Coli)

Recombinant Mouse Katanin p60 ATPase-containing subunit A1 (Katna1)

Sign In for Pricing
View Details
Recombinant Mouse Katanin p60 ATPase-containing subunit A1 (Katna1)
MBS1352223-02 0.02 mg (Yeast)

Recombinant Mouse Katanin p60 ATPase-containing subunit A1 (Katna1)

Sign In for Pricing
View Details