Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPLKIP Peptide - middle region

MPLKIP Peptide - middle region

Product Specifications

Product Name Alternative

ABHS, C7orf11, ORF20

UniProt

Q8TAP9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPLKIP Rabbit Polyclonal Antibody (orb326631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619646

Preservative

Lyophilized powder

AA Sequence

PGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV623000 1.0 µg DNA

TNFRSF17 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
HAVCR1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-20474R-BF405 100 µL

HAVCR1 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
APTX Antibody
orb1562286-01 50 µL

APTX Antibody

Sign In for Pricing
View Details
APTX Antibody
orb1562286-02 100 µL

APTX Antibody

Sign In for Pricing
View Details
APTX Antibody
orb1562286-03 200 µL

APTX Antibody

Sign In for Pricing
View Details
Rat Cnot4 Pre-designed siRNA Set B
SI202990B 1 Each

Rat Cnot4 Pre-designed siRNA Set B

Sign In for Pricing
View Details