MPLKIP Peptide - middle region
MPLKIP Peptide - middle region
Product Specifications
Product Name Alternative
ABHS, C7orf11, ORF20
UniProt
Q8TAP9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MPLKIP Rabbit Polyclonal Antibody (orb326631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_619646
Preservative
Lyophilized powder
AA Sequence
PGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
122944-ML550 100 µL
ACVR1 (Activin Receptor Type 1, Activin Receptor Type I, ACTR-I, Serine/Threonine-protein Kinase Receptor R1, SKR1, Activin Receptor-like Kinase 2, ALK-2, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2) (MaxLight 550)
Sign In for Pricing
View Details 
MBS6242854-01 0.1 mL
Respiratory Syncytial Virus, Nuclear Protein, 42-44kD (RSV) (Biotin)
Sign In for Pricing
View Details MBS6242854-02 5x 0.1 mL
Respiratory Syncytial Virus, Nuclear Protein, 42-44kD (RSV) (Biotin)
Sign In for Pricing
View Details 
