Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPRX Peptide - N-terminal region

DPRX Peptide - N-terminal region

Product Specifications

UniProt

A6NFQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPRX Rabbit Polyclonal Antibody (orb586672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012746

Preservative

Lyophilized powder

AA Sequence

KEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)
abx315367-01 20 µg

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)

Sign In for Pricing
View Details
Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)
abx315367-02 50 µg

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)

Sign In for Pricing
View Details
Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)
abx315367-03 100 µg

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)

Sign In for Pricing
View Details
Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)
abx315367-04 200 µg

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)

Sign In for Pricing
View Details
Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)
abx315367-05 1 mg

Fasciculation And Elongation Protein Zeta-1 (FEZ1) Antibody (FITC)

Sign In for Pricing
View Details
PGM3 (NM_015599) Human Mass Spec Standard
PH301522 10 µg

PGM3 (NM_015599) Human Mass Spec Standard

Sign In for Pricing
View Details