Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPRX Peptide - N-terminal region

DPRX Peptide - N-terminal region

Product Specifications

UniProt

A6NFQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPRX Rabbit Polyclonal Antibody (orb586672) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012746

Preservative

Lyophilized powder

AA Sequence

KEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine OTC ELISA Kit
E092502 1 Each

Bovine OTC ELISA Kit

Sign In for Pricing
View Details
Neurabin-I (D-4) Alexa Fluor® 647
sc-377407 AF647 200 µg/mL

Neurabin-I (D-4) Alexa Fluor® 647

Sign In for Pricing
View Details
Akp3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
11669124 3x 1.0µg DNA

Akp3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Research Grade Anti-SARS-CoV-2 RBD Antibody (VIR-7229)
DVV00356 100 μg

Research Grade Anti-SARS-CoV-2 RBD Antibody (VIR-7229)

Sign In for Pricing
View Details
Animal-Free IL-12, Human (HEK293, His)
HY-P700101AF-01 2 µg

Animal-Free IL-12, Human (HEK293, His)

Sign In for Pricing
View Details
Animal-Free IL-12, Human (HEK293, His)
HY-P700101AF-02 10 µg

Animal-Free IL-12, Human (HEK293, His)

Sign In for Pricing
View Details