Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MACROD2 Peptide - C-terminal region

MACROD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf133

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001028259

Preservative

Lyophilized powder

AA Sequence

GSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRNGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-miR-294-5p Virus
mm1271 250 µL

AdmiRa-mmu-miR-294-5p Virus

Sign In for Pricing
View Details
COL4A2 Protein Vector (Human) (pPM-C-His)
PV070340 500 ng

COL4A2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HARS Rabbit Polyclonal Antibody
orb514900 100 µg

HARS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Basic Cytokeratin Antibody (HMW / Type II)
V8314SAF-100UG 100 µg

Basic Cytokeratin Antibody (HMW / Type II)

Sign In for Pricing
View Details
Genesig Real-Time PCR detection kit for Fowlpox Virus, Standard discontinued
349032 1 Kit

Genesig Real-Time PCR detection kit for Fowlpox Virus, Standard discontinued

Sign In for Pricing
View Details
Anti-SLC9A7 Antibody Biotin Conjugated
A11831-2-Biotin 100 µg/Vial

Anti-SLC9A7 Antibody Biotin Conjugated

Sign In for Pricing
View Details