Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MACROD2 Peptide - C-terminal region

MACROD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf133

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001028259

Preservative

Lyophilized powder

AA Sequence

GSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRNGTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDF-1 α
E13-004-2 50 µg

SDF-1 α

Sign In for Pricing
View Details
Mouse Hermansky Pudlak syndrome 4 protein (HPS4) ELISA kit
GTR10394347 96 Well

Mouse Hermansky Pudlak syndrome 4 protein (HPS4) ELISA kit

Sign In for Pricing
View Details
ZNF227 Rabbit Polyclonal Antibody
TA341531 100 µL

ZNF227 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
U1SNRNPBP (SNRNP35) (NM_180699) Human Over-expression Lysate
LH15677V 100 µg

U1SNRNPBP (SNRNP35) (NM_180699) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal XLF Antibody (OTI3D6) [Alexa Fluor 647]
NBP2-74876AF647 0.1 mL

Mouse Monoclonal XLF Antibody (OTI3D6) [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Anti Human FTH1 Monoclonal Clone FBA-6 100ug
IRBAHUFTH1FBA6C100ug 100 µg

Rabbit Anti Human FTH1 Monoclonal Clone FBA-6 100ug

Sign In for Pricing
View Details