Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARS2 Peptide - C-terminal region

PARS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MT-PRORS

UniProt

Q7L3T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARS2 Rabbit Polyclonal Antibody (orb586716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689481

Preservative

Lyophilized powder

AA Sequence

AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Sema4c shRNA (UAS) - Lentiviral mouse Sema4c shRNA (UAS) (25)
GTR15280349 1 Vial

Lentiviral mouse Sema4c shRNA (UAS) - Lentiviral mouse Sema4c shRNA (UAS) (25)

Sign In for Pricing
View Details
D030056L22Rik Mouse shRNA Plasmid (Locus ID 225995)
TR519796 1 Kit

D030056L22Rik Mouse shRNA Plasmid (Locus ID 225995)

Sign In for Pricing
View Details
SV40 large T-antigen (Neo), CMV lentiviral particles
LVP016-Neo 1 x 10^7 IFU/mL - 200 µL

SV40 large T-antigen (Neo), CMV lentiviral particles

Sign In for Pricing
View Details
APC polyclonal antibody
BS78389-01 50 µL

APC polyclonal antibody

Sign In for Pricing
View Details
APC polyclonal antibody
BS78389-02 100 µL

APC polyclonal antibody

Sign In for Pricing
View Details
Hsd3b CRISPRa sgRNA lentivector (set of three targets)(Rat)
23945126 3x 1.0µg DNA

Hsd3b CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details