Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARS2 Peptide - C-terminal region

PARS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MT-PRORS

UniProt

Q7L3T8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARS2 Rabbit Polyclonal Antibody (orb586716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689481

Preservative

Lyophilized powder

AA Sequence

AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN2B2 Antibody
A71951-100UG 100 µg

MAN2B2 Antibody

Sign In for Pricing
View Details
SMYD4 Mouse Monoclonal Antibody
E38QA8325 100 µL

SMYD4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SE11) thrB Polyclonal Antibody
MBS7171648 Inquire

Rabbit anti-Escherichia coli (strain SE11) thrB Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Adiponectin (ADIPOQ) ELISA Kit
abx364469 96 Well

Sheep Adiponectin (ADIPOQ) ELISA Kit

Sign In for Pricing
View Details
IL1F9 (Interleukin 1 Family, Member 9, IL-1F9, IL36g, IL-1H1, IL-1RP2, IL1E, IL1H1, IL1RP2, Interleukin 36, Gamma, Interleukin-1 Homolog 1, Interleukin-1 epsilon, Interleukin 1-Related Protein 2)
363665 200 µL

IL1F9 (Interleukin 1 Family, Member 9, IL-1F9, IL36g, IL-1H1, IL-1RP2, IL1E, IL1H1, IL1RP2, Interleukin 36, Gamma, Interleukin-1 Homolog 1, Interleukin-1 epsilon, Interleukin 1-Related Protein 2)

Sign In for Pricing
View Details
Human E6AP/UBE3AF MAb (Clone 1077315)
MAB11546-100 100 µg

Human E6AP/UBE3AF MAb (Clone 1077315)

Sign In for Pricing
View Details