Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSOX2 Peptide - middle region

QSOX2 Peptide - middle region

Product Specifications

Product Name Alternative

QSCN6L1, SOXN

UniProt

Q6ZRP7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with QSOX2 Rabbit Polyclonal Antibody (orb586728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859052

Preservative

Lyophilized powder

AA Sequence

VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Kaiso Antibody
NBP3-35278-20ul 20 µL

Rabbit Polyclonal Kaiso Antibody

Sign In for Pricing
View Details
Rabbit anti-human glycine-N-acyltransferase-like 1 polyclonal Antibody
MBS713962-01 0.1 mL

Rabbit anti-human glycine-N-acyltransferase-like 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human glycine-N-acyltransferase-like 1 polyclonal Antibody
MBS713962-02 5x 0.1 mL

Rabbit anti-human glycine-N-acyltransferase-like 1 polyclonal Antibody

Sign In for Pricing
View Details
Beta-cypermetrin (1R,3R)-(S)-3-Phenoxypheny; Beta-cypermetrin (1S,3S)-(R)-3-Phenoxypheny
TRC-B972660-100MG 100 mg

Beta-cypermetrin (1R,3R)-(S)-3-Phenoxypheny; Beta-cypermetrin (1S,3S)-(R)-3-Phenoxypheny

Sign In for Pricing
View Details
DCAF1 binder 1
orb2278985-01 50 mg

DCAF1 binder 1

Sign In for Pricing
View Details
DCAF1 binder 1
orb2278985-02 5 mg

DCAF1 binder 1

Sign In for Pricing
View Details