QSOX2 Peptide - middle region
QSOX2 Peptide - middle region
Product Specifications
Product Name Alternative
QSCN6L1, SOXN
UniProt
Q6ZRP7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with QSOX2 Rabbit Polyclonal Antibody (orb586728) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_859052
Preservative
Lyophilized powder
AA Sequence
VVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWREFDKSKLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb3079891 100 µg
Ras-related protein Rab-3C Rab3C/3C Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details GR106246 96 Well
Nori® Human Angiopoietin-Like 4 (ANGPTL4) ELISA Kit
Sign In for Pricing
View Details 131388-ML650 100 µL
PKD2 (Polycystin-2, Autosomal Dominant Polycystic Kidney Disease Type II Protein, Polycystic Kidney Disease 2 Protein, Polycystwin, R48321) (MaxLight 650)
Sign In for Pricing
View Details 
MBS6316526-01 0.2 mL
LMAN2, CT (LMAN2, C5orf8, Vesicular integral-membrane protein VIP36, Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36) (AP)
Sign In for Pricing
View Details