Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASAL2 Peptide - N-terminal region

RASAL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NGAP

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASAL2 Rabbit Polyclonal Antibody (orb586730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_733793

Preservative

Lyophilized powder

AA Sequence

IPVEGGQEQQTDSTKGRCLRRTVSVPSEGQFPEYPPEGATKLEVPAERSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC29A2 Adenovirus (Rat)
44085056 1.0 mL

SLC29A2 Adenovirus (Rat)

Sign In for Pricing
View Details
Olfr604 shRNA (m) Lentiviral Particles
sc-150976-V 200 µL

Olfr604 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CD10/MME Rabbit pAb
E45R25994N-100 100 µL

CD10/MME Rabbit pAb

Sign In for Pricing
View Details
FDFT1 Rabbit mAb Antibody
orb1727272-01 50 µL

FDFT1 Rabbit mAb Antibody

Sign In for Pricing
View Details
FDFT1 Rabbit mAb Antibody
orb1727272-02 100 µL

FDFT1 Rabbit mAb Antibody

Sign In for Pricing
View Details
CDK5RAP1 shRNA (h) Lentiviral Particles
sc-72846-V 200 µL

CDK5RAP1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details