RASAL2 Peptide - N-terminal region
RASAL2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NGAP
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASAL2 Rabbit Polyclonal Antibody (orb586730) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_733793
Preservative
Lyophilized powder
AA Sequence
IPVEGGQEQQTDSTKGRCLRRTVSVPSEGQFPEYPPEGATKLEVPAERSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![(2S,5S) -1- (11bS) -Dinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-yl-2,5-diphenylpyrrolidine](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
OR1032754-01 100 mg
(2S,5S) -1- (11bS) -Dinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-yl-2,5-diphenylpyrrolidine
Sign In for Pricing
View Details OR1032754-02 250 mg
(2S,5S) -1- (11bS) -Dinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-yl-2,5-diphenylpyrrolidine
Sign In for Pricing
View Details OR1032754-03 1 g
(2S,5S) -1- (11bS) -Dinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-yl-2,5-diphenylpyrrolidine
Sign In for Pricing
View Details 
