Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC1B Peptide - N-terminal region

DEPDC1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCC3, XTP1

UniProt

Q8WUY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC1B Rabbit Polyclonal Antibody (orb586793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060839

Preservative

Lyophilized powder

AA Sequence

FGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXPH1 Antibody
8C16915-AAT 50 µg

NXPH1 Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Mouse Esrrg activation kit by CRISPRa
GA204934 1 Kit

Mouse Esrrg activation kit by CRISPRa

Sign In for Pricing
View Details
MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein
TP310483L 1 mg

MC2 receptor (MC2R) (NM_000529) Human Recombinant Protein

Sign In for Pricing
View Details