Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC1B Peptide - N-terminal region

DEPDC1B Peptide - N-terminal region

Product Specifications

Product Name Alternative

BRCC3, XTP1

UniProt

Q8WUY9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC1B Rabbit Polyclonal Antibody (orb586793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060839

Preservative

Lyophilized powder

AA Sequence

FGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZADH1 (PTGR2) activation kit by CRISPRa
GA115521 1 Kit

Human ZADH1 (PTGR2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human B7-1 (CD80) ELISA Kit 1 x 96
EA200057 96 Well

Human B7-1 (CD80) ELISA Kit 1 x 96

Sign In for Pricing
View Details
6b-Chloro-7a-hydroxy-6,7-dihydro Cyproterone Acetate
TRC-C366615-25MG 25 mg

6b-Chloro-7a-hydroxy-6,7-dihydro Cyproterone Acetate

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559146 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
IREB2 Mouse Monoclonal Antibody [9D1]
HA600015 100 µL

IREB2 Mouse Monoclonal Antibody [9D1]

Sign In for Pricing
View Details
Human TEM1 (CD248) activation kit by CRISPRa
GA111389 1 Kit

Human TEM1 (CD248) activation kit by CRISPRa

Sign In for Pricing
View Details