Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL2 Peptide - C-terminal region

HHIPL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1822L

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHIPL2 Rabbit Polyclonal Antibody (orb586816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079022

Preservative

Lyophilized powder

AA Sequence

SKNTLRGPGTKKKARVGPHVRQGKRRKSLKSHSGRMRPSAEQKRAGRSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP9-2 knockdown cell line
ABC-KD8235 1 Vial

Human KRTAP9-2 knockdown cell line

Sign In for Pricing
View Details
PDPK1 Polyclonal Antibody, Cy3 Conjugated
bs-2739R-Cy3 100 µL

PDPK1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human Integrin α-5/ITGA5 (C-6His)
C478-500ug 500 µg

Recombinant Human Integrin α-5/ITGA5 (C-6His)

Sign In for Pricing
View Details
PHETA1 (NM_001177997) Human Untagged Clone
SC328404 10 µg

PHETA1 (NM_001177997) Human Untagged Clone

Sign In for Pricing
View Details
GRIA3 Protein Vector (Rat) (pPB-N-His)
PV271491 500 ng

GRIA3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CellCounting-Lite 3D Luminescent Cell Viability Assay
DD1102-03 400 mL

CellCounting-Lite 3D Luminescent Cell Viability Assay

Sign In for Pricing
View Details