Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HHIPL2 Peptide - C-terminal region

HHIPL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA1822L

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HHIPL2 Rabbit Polyclonal Antibody (orb586816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079022

Preservative

Lyophilized powder

AA Sequence

SKNTLRGPGTKKKARVGPHVRQGKRRKSLKSHSGRMRPSAEQKRAGRSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAOB 3'UTR Luciferase Stable Cell Line
TU012930 1.0 mL

MAOB 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
USP21 Rabbit Polyclonal Antibody (Fluoro550)
orb3101492 100 µg

USP21 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)
MBS1344429-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)
MBS1344429-02 0.02 mg (Yeast)

Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)
MBS1344429-03 0.1 mg (E-Coli)

Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details
Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)
MBS1344429-04 0.1 mg (Yeast)

Recombinant Yersinia pestis Ribose-phosphate pyrophosphokinase (prs)

Sign In for Pricing
View Details