Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELR2 Peptide - middle region

KDELR2 Peptide - middle region

Product Specifications

Product Name Alternative

ELP-1, ERD2.2

UniProt

P33947

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELR2 Rabbit Polyclonal Antibody (orb586833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094073

Preservative

Lyophilized powder

AA Sequence

PVGGLSFLVNHDFSPLEYSRERSSVCQHKCQRPSPASVLQGARTEFLPQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTLA4 (NM_005214) Human Recombinant Protein
TP721230XL 1 mg

CTLA4 (NM_005214) Human Recombinant Protein

Sign In for Pricing
View Details
Adad1 (NM_001006977) Rat Tagged Lenti ORF Clone
RR213084L3 10 µg

Adad1 (NM_001006977) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
4-Aminobenzoic acid (potassium) (Standard)
HY-B1008AR-01 10 mg

4-Aminobenzoic acid (potassium) (Standard)

Sign In for Pricing
View Details
4-Aminobenzoic acid (potassium) (Standard)
HY-B1008AR-02 25 mg

4-Aminobenzoic acid (potassium) (Standard)

Sign In for Pricing
View Details
4-Aminobenzoic acid (potassium) (Standard)
HY-B1008AR-03 50 mg

4-Aminobenzoic acid (potassium) (Standard)

Sign In for Pricing
View Details
4-Aminobenzoic acid (potassium) (Standard)
HY-B1008AR-04 100 mg

4-Aminobenzoic acid (potassium) (Standard)

Sign In for Pricing
View Details