Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELR2 Peptide - middle region

KDELR2 Peptide - middle region

Product Specifications

Product Name Alternative

ELP-1, ERD2.2

UniProt

P33947

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KDELR2 Rabbit Polyclonal Antibody (orb586833) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094073

Preservative

Lyophilized powder

AA Sequence

PVGGLSFLVNHDFSPLEYSRERSSVCQHKCQRPSPASVLQGARTEFLPQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax-9 CRISPR Activation Plasmid (h2)
sc-403899-ACT-2 20 µg

Pax-9 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human DNAI3 Protein
E30P66960A 50 µg

Recombinant Human DNAI3 Protein

Sign In for Pricing
View Details
Rat Vascular adhesion protein-1 (VAP-1/AOC3) ELISA Kit
YLA1398RA-01 48 Tests

Rat Vascular adhesion protein-1 (VAP-1/AOC3) ELISA Kit

Sign In for Pricing
View Details
Rat Vascular adhesion protein-1 (VAP-1/AOC3) ELISA Kit
YLA1398RA-02 96 Tests

Rat Vascular adhesion protein-1 (VAP-1/AOC3) ELISA Kit

Sign In for Pricing
View Details
Mtus1 (NM_001005863) Mouse Tagged Lenti ORF Clone
MR211806L3 10 µg

Mtus1 (NM_001005863) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Protein FADD, FADD ELISA Kit
MBS913591-01 24 Well (LIMIT 1)

Human Protein FADD, FADD ELISA Kit

Sign In for Pricing
View Details