Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR9 Peptide - C-terminal region

TAAR9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA3, TAR3, TAR9, TRAR3

UniProt

Q96RI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAAR9 Rabbit Polyclonal Antibody (orb326688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778227

Preservative

Lyophilized powder

AA Sequence

RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanin (1-13) - (Neuroscience Peptides)
CRB1000399-01 0.5 mg

Galanin (1-13) - (Neuroscience Peptides)

Sign In for Pricing
View Details
Galanin (1-13) - (Neuroscience Peptides)
CRB1000399-02 1 mg

Galanin (1-13) - (Neuroscience Peptides)

Sign In for Pricing
View Details
Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)
MBS953271-01 0.02 mg (E-Coli)

Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)

Sign In for Pricing
View Details
Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)
MBS953271-02 0.02 mg (Yeast)

Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)

Sign In for Pricing
View Details
Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)
MBS953271-03 0.1 mg (E-Coli)

Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)

Sign In for Pricing
View Details
Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)
MBS953271-04 0.1 mg (Yeast)

Recombinant Bovine DNA polymerase delta subunit 2 (POLD2)

Sign In for Pricing
View Details