Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR9 Peptide - C-terminal region

TAAR9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA3, TAR3, TAR9, TRAR3

UniProt

Q96RI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAAR9 Rabbit Polyclonal Antibody (orb326688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778227

Preservative

Lyophilized powder

AA Sequence

RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Collagen alpha-1(I) chain Protein, His, Yeast-50ug
QP9077-ye-50ug 50ug

Recombinant Rat Collagen alpha-1(I) chain Protein, His, Yeast-50ug

Sign In for Pricing
View Details
SH2D7 Recombinant Protein (Mouse)
RP171596 100 µg

SH2D7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)
CSB-EP895734MO-01 20 µg

Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)

Sign In for Pricing
View Details
Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)
CSB-EP895734MO-02 100 µg

Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)

Sign In for Pricing
View Details
Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)
CSB-EP895734MO-03 1 mg

Recombinant Mouse Basic helix-loop-helix ARNT-like protein 1 (Bmal1)

Sign In for Pricing
View Details
SEMA3A Recombinant Protein
OPCD06893-10UG 10 µg

SEMA3A Recombinant Protein

Sign In for Pricing
View Details