Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAAR9 Peptide - C-terminal region

TAAR9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TA3, TAR3, TAR9, TRAR3

UniProt

Q96RI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAAR9 Rabbit Polyclonal Antibody (orb326688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778227

Preservative

Lyophilized powder

AA Sequence

RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM1 (NM_001033) Human Mass Spec Standard
PH300726 10 µg

RRM1 (NM_001033) Human Mass Spec Standard

Sign In for Pricing
View Details
Lentiviral mouse Spock3 shRNA (UAS) - Lentiviral mouse Spock3 shRNA (UAS) (25)
GTR15269633 1 Vial

Lentiviral mouse Spock3 shRNA (UAS) - Lentiviral mouse Spock3 shRNA (UAS) (25)

Sign In for Pricing
View Details
The K4 peptide
HY-P5600 1 Each

The K4 peptide

Sign In for Pricing
View Details
LOXL2 Peptide - middle region
MBS3245127-01 0.1 mg

LOXL2 Peptide - middle region

Sign In for Pricing
View Details
LOXL2 Peptide - middle region
MBS3245127-02 5x 0.1 mg

LOXL2 Peptide - middle region

Sign In for Pricing
View Details
ACAP1 Antibody
A11684-100UL 100 µL

ACAP1 Antibody

Sign In for Pricing
View Details