Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACO1 Peptide - C-terminal region

TACO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC44

UniProt

Q9BSH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TACO1 Rabbit Polyclonal Antibody (orb586900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057444

Preservative

Lyophilized powder

AA Sequence

NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOSC9 Protein Vector (Rat) (pPB-N-His)
PV266843 500 ng

EXOSC9 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit
ER1735 96 Tests

Rat GPT2/ALT2 (Alanine aminotransferase 2) ELISA Kit

Sign In for Pricing
View Details
ZNF700 Protein Lysate (Human) with C-Ha Tag
51741031 100 µg

ZNF700 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rab23 3'UTR GFP Stable Cell Line
TU167400 1.0 mL

Rab23 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Kappa Antibody
V3606SAF-100UG 100 µg

Recombinant Kappa Antibody

Sign In for Pricing
View Details
Elf-1 CRISPR Activation Plasmid (m)
sc-420153-ACT 20 µg

Elf-1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details