Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACO1 Peptide - C-terminal region

TACO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC44

UniProt

Q9BSH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TACO1 Rabbit Polyclonal Antibody (orb586900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057444

Preservative

Lyophilized powder

AA Sequence

NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAV2 Polyclonal Antibody, HRP Conjugated
bs-6160R-HRP 100 µL

VAV2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mouse Esophagus PrimaCell™1: Normal Esophageal Epithelial Cells Growth Supplements with Serum (for 500 mL medium)
9-33035 Set

Mouse Esophagus PrimaCell™1: Normal Esophageal Epithelial Cells Growth Supplements with Serum (for 500 mL medium)

Sign In for Pricing
View Details
Anti-Mouse SIGIRR Polyclonal Antibody
PMJ05701 100 μg

Anti-Mouse SIGIRR Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human PYROXD1 shRNA (UAS) - Lentiviral human PYROXD1 shRNA (UAS, iRFP) (25)
GTR15309209 1 Vial

Lentiviral human PYROXD1 shRNA (UAS) - Lentiviral human PYROXD1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Myomegalin CRISPR/Cas9 KO Plasmid (h)
sc-406466 20 µg

Myomegalin CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti-Albumin
A2722-1mg*25 25x 1 mg

Anti-Albumin

Sign In for Pricing
View Details