Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R5 Peptide - C-terminal region

TAS2R5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T2R5

UniProt

Q9NYW4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R5 Rabbit Polyclonal Antibody (orb586902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061853

Preservative

Lyophilized powder

AA Sequence

SWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPC2 (NM_006432) Human Over-expression Lysate
LC401935 20 µg

NPC2 (NM_006432) Human Over-expression Lysate

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF594 conjugate, 0.1mg/mL
BNC943175-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (rAMACR/1864), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRPM7 Polyclonal Antibody
E-AB-90064-01 60 µL

TRPM7 Polyclonal Antibody

Sign In for Pricing
View Details
TRPM7 Polyclonal Antibody
E-AB-90064-02 120 µL

TRPM7 Polyclonal Antibody

Sign In for Pricing
View Details
TRPM7 Polyclonal Antibody
E-AB-90064-03 200 µL

TRPM7 Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene AM RAM
H40045023.25G 25 g

Polystyrene AM RAM

Sign In for Pricing
View Details