Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAS2R5 Peptide - C-terminal region

TAS2R5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T2R5

UniProt

Q9NYW4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAS2R5 Rabbit Polyclonal Antibody (orb586902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061853

Preservative

Lyophilized powder

AA Sequence

SWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHKKMKVHSAGRRDVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFA Antibody
KC-3011-01 50 μL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
KC-3011-02 100 µL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
KC-3011-03 1 mL

TGFA Antibody

Sign In for Pricing
View Details
APOH Human
OM296950-01 10 µg

APOH Human

Sign In for Pricing
View Details
APOH Human
OM296950-02 2 µg

APOH Human

Sign In for Pricing
View Details
APOH Human
OM296950-03 1 mg

APOH Human

Sign In for Pricing
View Details